Bacterial repD protein

Product Overview

• Article Name: Bacterial repD protein
• Biozol Catalog Number: BYT-ORB358387
• Supplier Catalog Number: orb358387
• Alternative Catalog Number: BYT-ORB358387-1,BYT-ORB358387-100,BYT-ORB358387-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: repD, Replication initiation protein

Product Description

This Bacterial repD protein spans the amino acid sequence from region 1-311aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 53.5 kDa
• UniProt: P03065
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Staphylococcus aureus
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSTENHSNYLQNKDLDNFSKTGYSNSRLSGNFFTTPQPELSFDAMTIVGNLNKTNAKKLSDFMSTEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDLAFDFEDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFDDLHILKPDWTTPEKVKEQAMVYLLLNEE

Application Notes

• Application Notes: Biological Origin: Staphylococcus aureus. Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureusrepD.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureusrepD.