Bacterial GV51_0914 protein

Catalog Number: BYT-ORB358405
Article Name: Bacterial GV51_0914 protein
Biozol Catalog Number: BYT-ORB358405
Supplier Catalog Number: orb358405
Alternative Catalog Number: BYT-ORB358405-1, BYT-ORB358405-100, BYT-ORB358405-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Bacterial GV51_0914 protein spans the amino acid sequence from region 1-525aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 64.2 kDa
UniProt: D6SZ78
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Gardnerella vaginalis 5-1
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKDTFCSYYTNSDEITSYMVNRLEIEENDIILEPSAGEGIFIDQILNSNKMIQIDALDINAEAIKILNSKYQDLPSITVRETDTLLDERLDLLSSPELWIKQTDTLLDEQLNFFGSIGGHYNKVIGNPPYGAWQDYDKRAQLKKKYPGQYVKETYSLFLLRCISLLRNGGRLSFIIPDTYLFLNLHAKLRELLLTSTRIIEIITFPSKFFPGVSFGYSNLSIITLERTNKENALNNTVRIVQGFESANEFQLLLN
Application Notes: Biological Origin: Gardnerella vaginalis 5-1. Application Notes: This is His-tag protein