Horse PMP2 protein

Catalog Number: BYT-ORB358409
Article Name: Horse PMP2 protein
Biozol Catalog Number: BYT-ORB358409
Supplier Catalog Number: orb358409
Alternative Catalog Number: BYT-ORB358409-1,BYT-ORB358409-100,BYT-ORB358409-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: PMP2, Myelin P2 protein
This Horse PMP2 protein spans the amino acid sequence from region 2-132aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30.4 kDa
UniProt: P0C6G6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Equus caballus (Horse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SNKFLGTWKLTSSENFDEYMKALGVGLGTRSLGNLAGPTVIISKSGDVITIRTESGFKNTEISFKLGQEFEETTADNRKTKSTVTLAGGKLNQVQKWNGNETTIKRELVDGKMVVECSMASVVCTRIYEQV
Application Notes: Biological Origin: Equus caballus (Horse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Equus caballus (Horse) PMP2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Equus caballus (Horse) PMP2.