Human MKI67 protein

Product Overview

• Article Name: Human MKI67 protein
• Biozol Catalog Number: BYT-ORB358416
• Supplier Catalog Number: orb358416
• Alternative Catalog Number: BYT-ORB358416-1,BYT-ORB358416-100,BYT-ORB358416-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Antigen identified by monoclonal Ki 67 , Antigen identified by monoclonal Ki-67, Antigen KI-67, Antigen KI67 , Antigen Ki67, KI67_HUMAN, KIA, Marker of proliferation Ki-67, MIB 1, MIB, MKI67, PPP1R105, Proliferation marker protein Ki-67, Proliferation related Ki 67 antigen , Protein phosphatase 1 regulatory subunit 105, RP11-380J17.2

Product Description

This Human MKI67 protein spans the amino acid sequence from region 2720-3256aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 72.1 kDa
• UniProt: P46013
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: TKRHLRTRVQKVQVKEEPSAVKFTQTSGETTDADKEPAGEDKGIKALKESAKQTPAPAASVTGSRRRPRAPRESAQAIEDLAGFKDPAAGHTEESMTDDKTTKIPCKSSPELEDTATSSKRRPRTRAQKVEVKEELLAVGKLTQTSGETTHTDKEPVGEGKGTKAFKQPAKRKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPGHTEELANGAADSFTSAPKQTPDSGKPLKISRRVLRAPKVEPVGDV

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MKI67.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MKI67.