Fungi CDC19 protein

Product Overview

• Article Name: Fungi CDC19 protein
• Biozol Catalog Number: BYT-ORB358471
• Supplier Catalog Number: orb358471
• Alternative Catalog Number: BYT-ORB358471-1,BYT-ORB358471-100,BYT-ORB358471-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: cell division cycle protein 19

Product Description

This Fungi CDC19 protein spans the amino acid sequence from region 2-500aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 56.4 kDa
• UniProt: P00549
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SRLERLTSLNVVAGSDLRRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYHKSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDVDYPIPPNHEMIFTTDDKYAKACDDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVLEVVDDKTLKVKALNAGKICSHKGVNLPGTDVDLPALSEKDKEDLRFGVKNGVHMVFASFIRTANDVLTIREVLGEQGKDVKIIVKIENQQGVNNFDEILKV

Application Notes

• Application Notes: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) CDC19.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) CDC19.