Human SFTPD protein

Product Overview

• Article Name: Human SFTPD protein
• Biozol Catalog Number: BYT-ORB358513
• Supplier Catalog Number: orb358513
• Alternative Catalog Number: BYT-ORB358513-1,BYT-ORB358513-100,BYT-ORB358513-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Collectin-7 Lung surfactant protein D

Product Description

This Human SFTPD protein spans the amino acid sequence from region 21-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 35.2 kDa
• UniProt: P35247
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFT

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPD.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SFTPD.