Human TMPRSS2 protein

Product Overview

• Article Name: Human TMPRSS2 protein
• Biozol Catalog Number: BYT-ORB358525
• Supplier Catalog Number: orb358525
• Alternative Catalog Number: BYT-ORB358525-1,BYT-ORB358525-100,BYT-ORB358525-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: D16Ertd61e protein, Epitheliasin protein, FLJ41954 protein, MGC6821 protein, PP9284 protein, PRSS10 protein, Serine protease 10 protein, TMPRSS2 protein, TMPRSS2 ERG FUSION GENE, INCLUDED protein, TMPRSS2 ETV1 FUSION GENE, INCLUDED protein, TMPS2_HUMAN protein, Transmembrane protease serine 2 catalytic chain protein, Transmembrane protease, serine 2 protein, Transmembrane protease, serine 2, EC 3.4.219 protein

Product Description

This Human TMPRSS2 protein spans the amino acid sequence from region 106-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 44.8 kDa
• UniProt: O15393
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Protein Length: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Recombinant Human TMPRSS2 His tag protein enzyme activity is measured by its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC), The Km is 21.93µM.

Measured by Camostat Mesylate inhibit ratio on TMPRSS2, which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.03347-0.07945µM.