Viral HA protein

Product Overview

• Article Name: Viral HA protein
• Biozol Catalog Number: BYT-ORB358566
• Supplier Catalog Number: orb358566
• Alternative Catalog Number: BYT-ORB358566-1,BYT-ORB358566-100,BYT-ORB358566-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: HA, Hemagglutinin [Cleaved into, Hemagglutinin HA1 chain, Hemagglutinin HA2 chain]

Product Description

This Viral HA protein spans the amino acid sequence from region 16-339aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 52.4 kDa
• UniProt: Q67143
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Influenza A virus (strain A/Korea/426/1968 H2N2)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: DQICIGYHANNSTEKVDTILERNVTVTHAKDILEKTHNGKLCKLNGIPPLELGDCSIAGWLLGNPECDRLLSVPEWSYIMEKENPRYSLCYPGSFNDYEELKHLLSSVKHFEKVKILPKDRWTQHTTTGGSWACAVSGKPSFFRNMVWLTRKGSNYPVAKGSYNNTSGEQMLIIWGVHHPNDEAEQRALYQNVGTYVSVATSTLYKRSIPEIAARPKVNGLGRRMEFSWTLLDMWDTINFESTGNLVAPEYGFKI

Application Notes

• Application Notes: Biological Origin: Influenza A virus (strain A/Korea/426/1968 H2N2). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Korea/426/1968 H2N2) HA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Korea/426/1968 H2N2) HA.