Rat Allergen Phl p Vb protein

Product Overview

• Article Name: Rat Allergen Phl p Vb protein
• Biozol Catalog Number: BYT-ORB358650
• Supplier Catalog Number: orb358650
• Alternative Catalog Number: BYT-ORB358650-1,BYT-ORB358650-100,BYT-ORB358650-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Allergen Phl p Vb Allergen, Phl p 5b

Product Description

This Rat Allergen Phl p Vb protein spans the amino acid sequence from region 20-284aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 42.1 kDa
• UniProt: Q40963
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Phleum pratense (Common timothy)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGA

Application Notes

• Application Notes: Biological Origin: Phleum pratense (Common timothy). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phleum pratense (Common timothy) Phl p 5b.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phleum pratense (Common timothy) Phl p 5b.