Bacterial uvsY protein

Product Overview

• Article Name: Bacterial uvsY protein
• Biozol Catalog Number: BYT-ORB358656
• Supplier Catalog Number: orb358656
• Alternative Catalog Number: BYT-ORB358656-1,BYT-ORB358656-100,BYT-ORB358656-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: uvsY, Recombination protein uvsY

Product Description

This Bacterial uvsY protein spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 31.8 kDa
• UniProt: P04537
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Enterobacteria phage T4 (Bacteriophage T4)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Application Notes

• Application Notes: Biological Origin: Enterobacteria phage T4 (Bacteriophage T4). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) uvsY.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) uvsY.