Human ERVK-6 protein

Catalog Number: BYT-ORB358702
Article Name: Human ERVK-6 protein
Biozol Catalog Number: BYT-ORB358702
Supplier Catalog Number: orb358702
Alternative Catalog Number: BYT-ORB358702-1,BYT-ORB358702-100,BYT-ORB358702-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: EnvK2 protein Envelope polyprotein HERV-K(C7) envelope protein HERV-K(HML-2.HOM) envelope protein HERV-K108 envelope protein HERV-K_7p22.1 provirus ancestral Env polyprotein Cleaved into the following 2 chains, Surface protein Short name, SU Transmembrane protein Short name, TM
This Human ERVK-6 protein spans the amino acid sequence from region 90-632aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 77.5 kDa
UniProt: Q69384
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPMPAGAAAANYTYWAYVPFPPLIRAVTWMDNPTEVYVNDSVWVPGPIDDRCPAKPEEEGMMINISIGYHYPPICLGRAPGCLMPAVQNWLVEVPTVSPICRFTYHMVSGMSLRPRVNYLQDFSYQRSLKFRPKGKPCPKEIPKESKNTEVLVWEECVANSAVILQNNEFGTIIDWAPRGQFYHNCSGQTQSCPSAQVSPAVDSDLTESLDKHKHKKLQSFYPWEWGEKGISTPRPKIVSPVSGPEHPELWRLTV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ERVK-6.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ERVK-6.