Animal IFN gamma protein

Product Overview

• Article Name: Animal IFN gamma protein
• Biozol Catalog Number: BYT-ORB358720
• Supplier Catalog Number: orb358720
• Alternative Catalog Number: BYT-ORB358720-1,BYT-ORB358720-100,BYT-ORB358720-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: IFG Protein, IFI Protein, IFN gamma Protein, IFN, immune Protein, IFN-gamma Protein, IFNG Protein, IFNG_HUMAN Protein, Immune interferon Protein, Interferon gamma Protein

Product Description

This Animal IFN gamma protein spans the amino acid sequence from region 24-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 18.6 kDa
• UniProt: O35735
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Marmota monax (Woodchuck)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK

Application Notes

• Application Notes: Biological Origin: Marmota monax (Woodchuck). Application Notes: This is His-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Marmota monax (Woodchuck) IFNG.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Marmota monax (Woodchuck) IFNG.