Fungi CDH-1 protein
Catalog Number:
BYT-ORB358757
- Images (3)
| Article Name: | Fungi CDH-1 protein |
| Biozol Catalog Number: | BYT-ORB358757 |
| Supplier Catalog Number: | orb358757 |
| Alternative Catalog Number: | BYT-ORB358757-1,BYT-ORB358757-100,BYT-ORB358757-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Cellobiose-quinone oxidoreductase |
| This Fungi CDH-1 protein spans the amino acid sequence from region 19-208aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 36.3 kDa |
| UniProt: | Q01738 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG |
| Application Notes: | Biological Origin: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum). Application Notes: This is His-SUMO-tag protein |



