Bacterial fbpC protein

Product Overview

• Article Name: Bacterial fbpC protein
• Biozol Catalog Number: BYT-ORB358762
• Supplier Catalog Number: orb358762
• Alternative Catalog Number: BYT-ORB358762-1,BYT-ORB358762-100,BYT-ORB358762-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Acyl-CoA, diacylglycerol acyltransferase Antigen 85 complex C Short name, 85C Short name, Ag85C Fibronectin-binding protein C Short name, Fbps C

Product Description

This Bacterial fbpC protein spans the amino acid sequence from region 46-340aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 36.1 kDa
• UniProt: P9WQN8
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF

Application Notes

• Application Notes: Biological Origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) fbpC.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) fbpC.