Viral HBV-D protein

Product Overview

• Article Name: Viral HBV-D protein
• Biozol Catalog Number: BYT-ORB358768
• Supplier Catalog Number: orb358768
• Alternative Catalog Number: BYT-ORB358768-1,BYT-ORB358768-100,BYT-ORB358768-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: HBx Peptide X pX

Product Description

This Viral HBV-D protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 32.6 kDa
• UniProt: P03165
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA

Application Notes

• Application Notes: Biological Origin: Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D) X.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D) X.