E. coli glcC protein

Product Overview

• Article Name: E. coli glcC protein
• Biozol Catalog Number: BYT-ORB358819
• Supplier Catalog Number: orb358819
• Alternative Catalog Number: BYT-ORB358819-1,BYT-ORB358819-100,BYT-ORB358819-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: glcC, c3710, Glc operon transcriptional activator, Glc regulatory protein, HTH-type transcriptional regulator GlcC

Product Description

This E. coli glcC protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 44.8 kDa
• UniProt: P0ACL6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGHHLIRSAVPLEMNLS

Application Notes

• Application Notes: Biological Origin: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Application Notes: This is His-SUMO-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O6: H1 (strain CFT073 / ATCC 700928 / UPEC) glcC.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O6: H1 (strain CFT073 / ATCC 700928 / UPEC) glcC.