E. coli ppx protein
Catalog Number:
BYT-ORB358839
- Images (3)
| Article Name: | E. coli ppx protein |
| Biozol Catalog Number: | BYT-ORB358839 |
| Supplier Catalog Number: | orb358839 |
| Alternative Catalog Number: | BYT-ORB358839-1,BYT-ORB358839-100,BYT-ORB358839-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Metaphosphatase |
| This E. coli ppx protein spans the amino acid sequence from region 2-513aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 62 kDa |
| UniProt: | P0AFL7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | PIHDKSPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCIVGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQGWNVAMGASGTIKAAHEVLMEMGEKDGIITPERLEKLVKEVLRHRNFA |
| Application Notes: | Biological Origin: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Application Notes: This is his-tag protein |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O6: H1 (strain CFT073 / ATCC 700928 / UPEC) ppx. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli O6: H1 (strain CFT073 / ATCC 700928 / UPEC) ppx. |
Product Guarantee and Expert Support
