Mouse Loxl4 protein
Catalog Number:
BYT-ORB358896
- Images (3)
| Article Name: | Mouse Loxl4 protein |
| Biozol Catalog Number: | BYT-ORB358896 |
| Supplier Catalog Number: | orb358896 |
| Alternative Catalog Number: | BYT-ORB358896-1,BYT-ORB358896-100,BYT-ORB358896-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Lysyl oxidase-like protein 4 Lysyl oxidase-related protein C |
| This Mouse Loxl4 protein spans the amino acid sequence from region 26-757aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 85.9 kDa |
| UniProt: | Q924C6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QSSGTKKLRLVGPTDRPEEGRLEVLHQGQWGTVCDDDFALQEATVACRQLGFESALTWAHSAKYGQGEGPIWLDNVRCLGTEKTLDQCGSNGWGVSDCRHSEDVGVVCHPRRQHGYHSEKVSNALGPQGRRLEEVRLKPILASAKRHSPVTEGAVEVRYDGHWRQVCDQGWTMNNSRVVCGMLGFPSQTSVNSHYYRKVWNLKMKDPKSRLNSLTKKNSFWIHRVDCLGTEPHLAKCQVQVAPGRGKLRPACPGG |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein |



