Human NR2F6 protein

Product Overview

• Article Name: Human NR2F6 protein
• Biozol Catalog Number: BYT-ORB358942
• Supplier Catalog Number: orb358942
• Alternative Catalog Number: BYT-ORB358942-20,BYT-ORB358942-100,BYT-ORB358942-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: V-erbA-related protein 2 Short name, EAR-2

Product Description

Recombinant human NR2F6 protein

Product Properties

• Molecular Weight: 47 kDa
• UniProt: P10588
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLH

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of HIS-tag protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of NR2F6 was greater than 95% as determined by SEC-HPLC