Human IL17 protein (Active)

Product Overview

• Article Name: Human IL17 protein (Active)
• Biozol Catalog Number: BYT-ORB358981
• Supplier Catalog Number: orb358981
• Alternative Catalog Number: BYT-ORB358981-100,BYT-ORB358981-5,BYT-ORB358981-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: IL-17, Cytotoxic T-lymphocyte-associated antigen 8, CTLA-8

Product Description

This Human IL17 protein (Active) spans the amino acid sequence from region 24-155aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 15.1 kDa
• UniProt: Q16552
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Source: Homo sapiens (Human)
• Purity: > 95% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 7.5 ng/ml, corresponding to a specific activity of > 1.3 x 10 5 IU/mg. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

orb358981

orb358981