Human SDF1 protein (Active)

Product Overview

• Article Name: Human SDF1 protein (Active)
• Biozol Catalog Number: BYT-ORB359058
• Supplier Catalog Number: orb359058
• Alternative Catalog Number: BYT-ORB359058-10,BYT-ORB359058-100,BYT-ORB359058-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: C-X-C motif chemokine 12 protein, CXCL12 protein, CXCL-12 protein, CXCL 12 protein, hIRH protein, hSDF-1 protein, Intercrine reduced in hepatomas protein, IRH protein, PBSF protein, SCYB12 protein, SDF 1 alpha protein, SDF 1 protein, SDF 1 beta protein, SDF 1b protein, SDF-1 protein, SDF-1a protein, SDF-1b protein, SDF1 protein, SDF1a protein, SDF1b protein, Stromal cell derived factor 1 protein, TLSF a protein, TLSF protein, TLSF b protein, TLSF-a protein, TLSF-b protein, TLSFa protein, TLSFb protein, TPAR1 protein

Product Description

This Human SDF1 protein (Active) spans the amino acid sequence from region 22-89aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 8.0 kDa
• UniProt: P48061
• Buffer: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Source: Homo sapiens (Human)
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

orb359058

orb359058