Human CCL20 protein (Active)

Product Overview

• Article Name: Human CCL20 protein (Active)
• Biozol Catalog Number: BYT-ORB359077
• Supplier Catalog Number: orb359077
• Alternative Catalog Number: BYT-ORB359077-100,BYT-ORB359077-5,BYT-ORB359077-500
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Beta-chemokine exodus-1, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha, MIP-3-alpha, Small-inducible cytokine A20

Product Description

This Human CCL20 protein (Active) spans the amino acid sequence from region 27-96aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Properties

• Molecular Weight: 8.0 kDa
• UniProt: P78556
• Buffer: Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
• Source: Homo sapiens (Human)
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Form: Lyophilized powder
• Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-50 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Images

orb359077

orb359077