Human OGN protein

Product Overview

• Article Name: Human OGN protein
• Biozol Catalog Number: BYT-ORB383003
• Supplier Catalog Number: orb383003
• Alternative Catalog Number: BYT-ORB383003-1,BYT-ORB383003-100,BYT-ORB383003-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Corneal keratan sulfate proteoglycan, DKFZP586P2421, MIME_HUMAN, Mimecan, Mimecan proteoglycan, OG, OGN, OIF, Osteoglycin, Osteoinductive factor, SLRR3A

Product Description

This Human OGN protein spans the amino acid sequence from region 21-298aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 33.7 kDa
• UniProt: P20774
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid: Tris/PBS-based buffer, 5%-50% glycerol.
• Sequence: PPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKE SAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDH NALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLE

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) OGN.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) OGN.

Based on the SEQUEST from database of Yeast hos