Bacterial dnaK protein

Product Overview

• Article Name: Bacterial dnaK protein
• Biozol Catalog Number: BYT-ORB383043
• Supplier Catalog Number: orb383043
• Alternative Catalog Number: BYT-ORB383043-1,BYT-ORB383043-100,BYT-ORB383043-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: HSP70 Heat shock 70KDA protein Heat shock protein 70

Product Description

This Bacterial dnaK protein spans the amino acid sequence from region 423-595aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 35.5 kDa
• UniProt: P75344
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ

Application Notes

• Application Notes: Biological Origin: Mycoplasma pneumoniae (strain ATCC 29342 / M129). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycoplasma pneumoniae (strain ATCC 29342 / M129) dnaK.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycoplasma pneumoniae (strain ATCC 29342 / M129) dnaK.