Rat S100a9 protein

Catalog Number: BYT-ORB383271
Article Name: Rat S100a9 protein
Biozol Catalog Number: BYT-ORB383271
Supplier Catalog Number: orb383271
Alternative Catalog Number: BYT-ORB383271-1,BYT-ORB383271-100,BYT-ORB383271-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Calgranulin-B Migration inhibitory factor-related protein 14 Short name, MRP-14 Short name, p14 Myeloid-related protein 14 S100 calcium-binding protein A9
This Rat S100a9 protein spans the amino acid sequence from region 2-113aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29 kDa
UniProt: P50116
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a9.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a9.
SDS-PAGE analysis of Rat S100a9 protein.