Viral UL83 protein

Product Overview

• Article Name: Viral UL83 protein
• Biozol Catalog Number: BYT-ORB383370
• Supplier Catalog Number: orb383370
• Alternative Catalog Number: BYT-ORB383370-20,BYT-ORB383370-100,BYT-ORB383370-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: 65KDA matrix phosphoprotein Phosphoprotein UL83 Tegument protein UL83

Product Description

This Viral UL83 protein spans the amino acid sequence from region 351-480. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 18.2 kDa
• UniProt: P06725
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA

Application Notes

• Application Notes: Biological Origin: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) UL83.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) UL83.