Plant Cyanovirin-N homolog protein

Product Overview

• Article Name: Plant Cyanovirin-N homolog protein
• Biozol Catalog Number: BYT-ORB383371
• Supplier Catalog Number: orb383371
• Alternative Catalog Number: BYT-ORB383371-20,BYT-ORB383371-100,BYT-ORB383371-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cyanovirin-N homolog, CV-N homolog

Product Description

This Plant Cyanovirin-N homolog protein spans the amino acid sequence from region 28-142aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 14.4 kDa
• UniProt: P86326
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Ceratopteris richardii (Triangle waterfern)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE

Application Notes

• Application Notes: Biological Origin: Ceratopteris richardii (Triangle waterfern). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Ceratopteris richardii (Triangle waterfern) Cyanovirin-N homolog.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Ceratopteris richardii (Triangle waterfern) Cyanovirin-N homolog.