Viral Nucleoprotein protein

Product Overview

• Article Name: Viral Nucleoprotein protein
• Biozol Catalog Number: BYT-ORB383398
• Supplier Catalog Number: orb383398
• Alternative Catalog Number: BYT-ORB383398-20,BYT-ORB383398-100,BYT-ORB383398-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Nucleocapsid protein

Product Description

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-482aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 68 kDa
• UniProt: P27317
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Crimean-Congo hemorrhagic fever virus
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MENKIEVNNKDEMNKWFEEFKKGNGLVDTFTNPYSFCESVPNLERFVFQMASATDDAQKDSIYASALVEATKFCAPIYECAWVSSTGIVKKGLEWFEKNAGTIKSWDESYIELKVEVPKIEQLANYQQAALKWRKDIGFRVNANTAALSHKVLAEYKVPGEIVMSVKEMLSDMIRRRNLILNRGGDENPRGPVSREHVEWCREFVKGKYIMAFNPPWGDINKSGRSGIALVATGLAKLAETEGKGVFDEAKKTVE

Application Notes

• Application Notes: Biological Origin: Crimean-Congo hemorrhagic fever virus. Application Notes: E.coli and Yeast N-terminal 6xHis-B2M-tagged Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Crimean-Congo hemorrhagic fever virus (isolate C68031) (CCHFV) N.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Crimean-Congo hemorrhagic fever virus (isolate C68031) (CCHFV) N.