Viral Nucleoprotein protein
Catalog Number:
BYT-ORB383398
- Images (3)
| Article Name: | Viral Nucleoprotein protein |
| Biozol Catalog Number: | BYT-ORB383398 |
| Supplier Catalog Number: | orb383398 |
| Alternative Catalog Number: | BYT-ORB383398-20,BYT-ORB383398-100,BYT-ORB383398-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Nucleocapsid protein |
| This Viral Nucleoprotein protein spans the amino acid sequence from region 1-482aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 68 kDa |
| UniProt: | P27317 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Crimean-Congo hemorrhagic fever virus |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MENKIEVNNKDEMNKWFEEFKKGNGLVDTFTNPYSFCESVPNLERFVFQMASATDDAQKDSIYASALVEATKFCAPIYECAWVSSTGIVKKGLEWFEKNAGTIKSWDESYIELKVEVPKIEQLANYQQAALKWRKDIGFRVNANTAALSHKVLAEYKVPGEIVMSVKEMLSDMIRRRNLILNRGGDENPRGPVSREHVEWCREFVKGKYIMAFNPPWGDINKSGRSGIALVATGLAKLAETEGKGVFDEAKKTVE |
| Application Notes: | Biological Origin: Crimean-Congo hemorrhagic fever virus. Application Notes: E.coli and Yeast N-terminal 6xHis-B2M-tagged Full Length |



