Viral NP protein

Product Overview

• Article Name: Viral NP protein
• Biozol Catalog Number: BYT-ORB383433
• Supplier Catalog Number: orb383433
• Alternative Catalog Number: BYT-ORB383433-1,BYT-ORB383433-100,BYT-ORB383433-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: NP, Nucleoprotein, Nucleocapsid protein, Protein N

Product Description

This Viral NP protein spans the amino acid sequence from region 1-498aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 70.2 kDa
• UniProt: P03466
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGNAEFED

Application Notes

• Application Notes: Biological Origin: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1). Application Notes: E.coli and Yeast N-terminal 6xHis-B2M-tagged Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.