Bacterial rgpA protein

Catalog Number: BYT-ORB383435
Article Name: Bacterial rgpA protein
Biozol Catalog Number: BYT-ORB383435
Supplier Catalog Number: orb383435
Alternative Catalog Number: BYT-ORB383435-20,BYT-ORB383435-100,BYT-ORB383435-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: rgpA, rgp1Gingipain R1, EC 3.4.22.37, Arg-gingipain, Gingipain 1, RGP-1
Recombinant bacterial rgpA protein
Molecular Weight: 58 kDa
UniProt: P28784
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Porphyromonas gingivalis
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YTPVEEKQNGRMIVIVAKKYEGDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENVIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACVNGDFLFSMPC
Application Notes: Biological Origin: Porphyromonas gingivalis. Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.