Birds bsk protein

Catalog Number: BYT-ORB383447
Article Name: Birds bsk protein
Biozol Catalog Number: BYT-ORB383447
Supplier Catalog Number: orb383447
Alternative Catalog Number: BYT-ORB383447-20,BYT-ORB383447-100,BYT-ORB383447-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: dJNK Alternative name(s), Protein basket
Recombinant birds bsk protein
Molecular Weight: 45 kDa
UniProt: P92208
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Drosophila melanogaster (Fruit fly)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVR
Application Notes: Biological Origin: Drosophila melanogaster (Fruit fly). Application Notes: Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Extracellular Domain