Human COLEC11 protein

Product Overview

• Article Name: Human COLEC11 protein
• Biozol Catalog Number: BYT-ORB383472
• Supplier Catalog Number: orb383472
• Alternative Catalog Number: BYT-ORB383472-1,BYT-ORB383472-100,BYT-ORB383472-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Collectin kidney protein 1 Short name, CL-K1

Product Description

This Human COLEC11 protein spans the amino acid sequence from region 26-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 30.1 kDa
• UniProt: Q9BWP8
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) COLEC11.

Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) COLEC11.