Human SPRED1 protein

Product Overview

• Article Name: Human SPRED1 protein
• Biozol Catalog Number: BYT-ORB418693
• Supplier Catalog Number: orb418693
• Alternative Catalog Number: BYT-ORB418693-20,BYT-ORB418693-100,BYT-ORB418693-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: EVH1 domain-containing protein 1, EVH1/Sprouty domain containing protein, FLJ33903, hSpred 1, hSpred1, NFLS, PPP1R147, protein phosphatase 1 regulatory subunit 147, SPRE1_HUMAN, SPRED 1, Spred-1, spred1, Sprouty related EVH1 domain containing 1, sprouty related EVH1 domain containing protein 1, Sprouty related protein 1 with EVH 1 domain, Sprouty-related, Suppressor of Ras/MAPK activation

Product Description

This Human SPRED1 protein spans the amino acid sequence from region 2-444aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 70.3 kDa
• UniProt: Q7Z699
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIR

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2-444aaSequence Info: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPRED1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SPRED1.