Mouse CD63 protein

Product Overview

• Article Name: Mouse CD63 protein
• Biozol Catalog Number: BYT-ORB418710
• Supplier Catalog Number: orb418710
• Alternative Catalog Number: BYT-ORB418710-20,BYT-ORB418710-100,BYT-ORB418710-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: CD63

Product Description

This Mouse CD63 protein spans the amino acid sequence from region 103-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 38.5 kDa
• UniProt: P41731
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mus musculus (Mouse)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Application Notes

• Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal GST-taggedExpression Region: 103-203aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.