Human TARDBP protein

Product Overview

• Article Name: Human TARDBP protein
• Biozol Catalog Number: BYT-ORB418748
• Supplier Catalog Number: orb418748
• Alternative Catalog Number: BYT-ORB418748-20,BYT-ORB418748-100,BYT-ORB418748-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: ALS10, OTTHUMP00000002171, OTTHUMP00000002172, OTTHUMP00000002173, TADBP_HUMAN, TAR DNA binding protein 43, TAR DNA binding protein, TAR DNA-binding protein 43, TARDBP, TDP 43, TDP-43, TDP43

Product Description

This Human TARDBP protein spans the amino acid sequence from region 1-414aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 58.9 kDa
• UniProt: Q13148
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Protein Length: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.