Yeast ATG1 protein

Catalog Number: BYT-ORB418766
Article Name: Yeast ATG1 protein
Biozol Catalog Number: BYT-ORB418766
Supplier Catalog Number: orb418766
Alternative Catalog Number: BYT-ORB418766-20,BYT-ORB418766-100,BYT-ORB418766-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Autophagy-related protein 1
This Yeast ATG1 protein spans the amino acid sequence from region 11-312aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 38.4 kDa
UniProt: Q6FL58
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKK
Application Notes: Biological Origin: Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 11-312aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) ATG1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) ATG1.