Human HLA-G protein

Product Overview

• Article Name: Human HLA-G protein
• Biozol Catalog Number: BYT-ORB418772
• Supplier Catalog Number: orb418772
• Alternative Catalog Number: BYT-ORB418772-20,BYT-ORB418772-100,BYT-ORB418772-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: HLA G antigen, MHC class I antigen G

Product Description

This Human HLA-G protein spans the amino acid sequence from region 25-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 51.6 kDa
• UniProt: P17693
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQ

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-338aaSequence Info: Partial

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

SDS-Page analysis of Human HLA-G protein.