Viral GPC protein

Product Overview

• Article Name: Viral GPC protein
• Biozol Catalog Number: BYT-ORB418804
• Supplier Catalog Number: orb418804
• Alternative Catalog Number: BYT-ORB418804-20,BYT-ORB418804-100,BYT-ORB418804-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Stable signal peptide Short name, SSP Glycoprotein G1 Short name, GP1 Glycoprotein G2 Short name, GP2

Product Description

This Viral GPC protein spans the amino acid sequence from region 266-498aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 42.4 kDa
• UniProt: P09991
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR

Application Notes

• Application Notes: Biological Origin: Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 266-498aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) GPC.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) GPC.