Bacterial GELE protein
Catalog Number:
BYT-ORB418811
- Images (3)
| Article Name: | Bacterial GELE protein |
| Biozol Catalog Number: | BYT-ORB418811 |
| Supplier Catalog Number: | orb418811 |
| Alternative Catalog Number: | BYT-ORB418811-20,BYT-ORB418811-100,BYT-ORB418811-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Coccolysin |
| This Bacterial GELE protein spans the amino acid sequence from region 193-510aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 47.5 kDa |
| UniProt: | Q833V7 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Enterococcus faecalis (strain ATCC 700802 / V583) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYS |
| Application Notes: | Biological Origin: Enterococcus faecalis (strain ATCC 700802 / V583). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 193-510aaSequence Info: Full Length of Isoform 3 |



