Bacterial GELE protein

Product Overview

• Article Name: Bacterial GELE protein
• Biozol Catalog Number: BYT-ORB418811
• Supplier Catalog Number: orb418811
• Alternative Catalog Number: BYT-ORB418811-20,BYT-ORB418811-100,BYT-ORB418811-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Coccolysin

Product Description

This Bacterial GELE protein spans the amino acid sequence from region 193-510aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 47.5 kDa
• UniProt: Q833V7
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Enterococcus faecalis (strain ATCC 700802 / V583)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: VGSEVTLKNSFQVAFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSIIQAPSLVALNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFWDGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYIISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYNSGIINRIGYTIIQNLGIEKAQTIFYS

Application Notes

• Application Notes: Biological Origin: Enterococcus faecalis (strain ATCC 700802 / V583). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 193-510aaSequence Info: Full Length of Isoform 3

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterococcus faecalis (strain ATCC 700802 / V583) gelE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Enterococcus faecalis (strain ATCC 700802 / V583) gelE.