Rat GLP1R protein

Catalog Number: BYT-ORB418823
Article Name: Rat GLP1R protein
Biozol Catalog Number: BYT-ORB418823
Supplier Catalog Number: orb418823
Alternative Catalog Number: BYT-ORB418823-20,BYT-ORB418823-100,BYT-ORB418823-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Short name, GLP-1 receptor Short name, GLP-1-R Short name, GLP-1R
This Rat GLP1R protein spans the amino acid sequence from region 22-135aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 17.1 kDa
UniProt: P32301
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 22-135aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.