Bacterial Angiotensinogen protein

Product Overview

• Article Name: Bacterial Angiotensinogen protein
• Biozol Catalog Number: BYT-ORB418827
• Supplier Catalog Number: orb418827
• Alternative Catalog Number: BYT-ORB418827-20,BYT-ORB418827-100,BYT-ORB418827-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: PPT N-acetyltransferase, Phosphinothricin-resistance protein

Product Description

This Bacterial Angiotensinogen protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 22.6 kDa
• UniProt: Q57146
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Streptomyces viridochromogenes
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI

Application Notes

• Application Notes: Biological Origin: Streptomyces viridochromogenes. Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-183aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494) pat.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494) pat.