Mouse BAS1 protein

Product Overview

• Article Name: Mouse BAS1 protein
• Biozol Catalog Number: BYT-ORB418830
• Supplier Catalog Number: orb418830
• Alternative Catalog Number: BYT-ORB418830-20,BYT-ORB418830-100,BYT-ORB418830-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Thiol-specific antioxidant protein A

Product Description

This Mouse BAS1 protein spans the amino acid sequence from region 66-266aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 26.4 kDa
• UniProt: Q96291
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Arabidopsis thaliana (Mouse-ear cress)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI

Application Notes

• Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 66-266aaSequence Info: Full Length

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.