Human UL128 protein

Product Overview

• Article Name: Human UL128 protein
• Biozol Catalog Number: BYT-ORB418833
• Supplier Catalog Number: orb418833
• Alternative Catalog Number: BYT-ORB418833-20,BYT-ORB418833-100,BYT-ORB418833-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: UL128Uncharacterized protein UL128

Product Description

This Human UL128 protein spans the amino acid sequence from region 1-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 19.7 kDa
• UniProt: P16837
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ

Application Notes

• Application Notes: Biological Origin: Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5). Application Notes: Tag Info: NO-taggedExpression Region: 1-171aaSequence Info: Extracellular Domain

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.