Human EGFP protein

Product Overview

• Article Name: Human EGFP protein
• Biozol Catalog Number: BYT-ORB418835
• Supplier Catalog Number: orb418835
• Alternative Catalog Number: BYT-ORB418835-20,BYT-ORB418835-100,BYT-ORB418835-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: /

Product Description

This Human EGFP protein spans the amino acid sequence from region 1-239aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 30.9 kDa
• UniProt: C5MKY7
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Application Notes

• Application Notes: Biological Origin: Human cytomegalovirus (HHV-5) (Human herpesvirus 5). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-239aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.