Pig GPX5 protein

Catalog Number: BYT-ORB418837
Article Name: Pig GPX5 protein
Biozol Catalog Number: BYT-ORB418837
Supplier Catalog Number: orb418837
Alternative Catalog Number: BYT-ORB418837-20,BYT-ORB418837-100,BYT-ORB418837-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Epididymis-specific glutathione peroxidase-like protein Short name, EGLP
This Pig GPX5 protein spans the amino acid sequence from region 22-219aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.6 kDa
UniProt: O18994
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 22-219aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.