Plant Cyanovirin-N homolog protein

Catalog Number: BYT-ORB418839
Article Name: Plant Cyanovirin-N homolog protein
Biozol Catalog Number: BYT-ORB418839
Supplier Catalog Number: orb418839
Alternative Catalog Number: BYT-ORB418839-20,BYT-ORB418839-100,BYT-ORB418839-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cyanovirin-N homolog, CV-N homolog
This Plant Cyanovirin-N homolog protein spans the amino acid sequence from region 28-142aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 12.4 kDa
UniProt: P86326
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Ceratopteris richardii (Triangle waterfern)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
Application Notes: Biological Origin: Ceratopteris richardii (Triangle waterfern). Application Notes: Tag Info: NO-taggedExpression Region: 28-142aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.