Bacterial ENTH protein

Catalog Number: BYT-ORB418852
Article Name: Bacterial ENTH protein
Biozol Catalog Number: BYT-ORB418852
Supplier Catalog Number: orb418852
Alternative Catalog Number: BYT-ORB418852-20,BYT-ORB418852-100,BYT-ORB418852-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: SEH
This Bacterial ENTH protein spans the amino acid sequence from region 25-241aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.6 kDa
UniProt: P0A0M0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV
Application Notes: Biological Origin: Staphylococcus aureus. Application Notes: Tag Info: N-terminal 10xHis-taggedExpression Region: 25-241aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.