Bacterial ENTH protein

Product Overview

• Article Name: Bacterial ENTH protein
• Biozol Catalog Number: BYT-ORB418853
• Supplier Catalog Number: orb418853
• Alternative Catalog Number: BYT-ORB418853-20,BYT-ORB418853-100,BYT-ORB418853-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: SEH

Product Description

This Bacterial ENTH protein spans the amino acid sequence from region 25-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 27.1 kDa
• UniProt: P0A0M0
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Staphylococcus aureus
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV

Application Notes

• Application Notes: Biological Origin: Staphylococcus aureus. Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 25-241aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Staphylococcus aureusentH.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Staphylococcus aureusentH.