Rabbit Apolipoprotein E protein

Product Overview

• Article Name: Rabbit Apolipoprotein E protein
• Biozol Catalog Number: BYT-ORB418881
• Supplier Catalog Number: orb418881
• Alternative Catalog Number: BYT-ORB418881-20,BYT-ORB418881-100,BYT-ORB418881-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: APOEApolipoprotein E, Apo-E

Product Description

This Rabbit Apolipoprotein E protein spans the amino acid sequence from region 20-311aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 53.6 kDa
• UniProt: P18287
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Oryctolagus cuniculus (Rabbit)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKS

Application Notes

• Application Notes: Biological Origin: Oryctolagus cuniculus (Rabbit). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 20-311aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.