Human IFNA14 protein

Product Overview

• Article Name: Human IFNA14 protein
• Biozol Catalog Number: BYT-ORB418887
• Supplier Catalog Number: orb418887
• Alternative Catalog Number: BYT-ORB418887-20,BYT-ORB418887-100,BYT-ORB418887-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Interferon alpha-H

Product Description

This Human IFNA14 protein spans the amino acid sequence from region 24-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Properties

• Molecular Weight: 35.7 kDa
• UniProt: P01570
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-189aaSequence Info: Full Length of Mature Protein

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.